Recombinant Mouse Ephrin-B2/EFNB2 Protein
Product Sizes
10 ug
£127.00
RP01468-10UG
20 ug
£175.00
RP01468-20UG
50 ug
£240.00
RP01468-50UG
100 ug
£336.00
RP01468-100UG
About this Product
- SKU:
- RP01468
- Additional Names:
- Epl5,ELF-2,Eplg5,Htk-L,Lerk5,LERK-5,NLERK-1,EFNB2
- Extra Details:
- Recombinant Mouse Ephrin-B2/EFNB2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg29-Ala232) of mouse Ephrin-B2/EFNB2 (Accession #NP_034241.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg29-Ala232
- Molecular Weight:
- 23.21 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RSIVLEPIYWNSSNSKFLPGQGLVLYPQIGDKLDIICPKVDSKTVGQYEYYKVYMVDKDQADRCTIKKENTPLLNCARPDQDVKFTIKFQEFSPNLWGLEFQKNKDYYIISTSNGSLEGLDNQEGGVCQTRAMKILMKVGQDASSAGSARNHGPTRRPELEAGTNGRSSTTSPFVKPNPGSSTDGNSAGHSGNNLLGSEVALFA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01468








