Recombinant Mouse Basigin/EMMPRIN/CD147 Protein
Product Sizes
10 ug
£127.00
RP01467-10UG
20 ug
£175.00
RP01467-20UG
50 ug
£240.00
RP01467-50UG
100 ug
£336.00
RP01467-100UG
500 ug
£1002.00
RP01467-500UG
1000 ug
£1574.00
RP01467-1000UG
About this Product
- SKU:
- RP01467
- Additional Names:
- CD147
- Extra Details:
- This protein is a plasma membrane protein that is important in spermatogenesis, embryo implantation, neural network formation, and tumor progression. The encoded protein is also a member of the immunoglobulin superfamily. Multiple transcript variants encoding different isoforms have been found for this gene.
- Formulation:
- Recombinant Mouse Basigin/EMMPRIN/CD147 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala22-Ala211) of mouse CD147/EMMPRIN/Basigin (Accession #N
- Immunogen:
- Ala22-Ala211
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- AAGTIQTSVQEVNSKTQLTCSLNSSGVDIVGHRWMRGGKVLQEDTLPDLHTKYIVDADDRSGEYSCIFLPEPVGRSEINVEGPPRIKVGKKSEHSSEGELAKLVCKSDASYPPITDWFWFKTSDTGEEEAITNSTEANGKYVVVSTPEKSQLTISNLDVNVDPGTYVCNATNAQGTTRETISLRVRSRMA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01467
