Recombinant Mouse Adiponectin/Acrp30/ADIPOQ Protein
Product Sizes
10 ug
£133.00
RP01466-10UG
20 ug
£181.00
RP01466-20UG
100 ug
£353.00
RP01466-100UG
About this Product
- SKU:
- RP01466
- Additional Names:
- Adiponectin
- Extra Details:
- Recombinant Mouse Adiponectin/Acrp30/ADIPOQ Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu18-Asn247) of mouse Adiponectin/Acrp30 (Accession #NP_033735.3) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu18-Asn247
- Molecular Weight:
- 25.76 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- EDDVTTTEELAPALVPPPKGTCAGWMAGIPGHPGHNGTPGRDGRDGTPGEKGEKGDAGLLGPKGETGDVGMTGAEGPRGFPGTPGRKGEPGEAAYVYRSAFSVGLETRVTVPNVPIRFTKIFYNQQNHYDGSTGKFYCNIPGLYYFSYHITVYMKDVKVSLFKKDKAVLFTYDQYQEKNVDQASGSVLLHLEVGDQVWLQVYGDGDHNGLYADNVNDSTFTGFLLYHDTN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01466
