Recombinant Mouse Apolipoprotein A-I/APOA1 Protein
Product Sizes
10 ug
£145.00
RP01463-10UG
20 ug
£193.00
RP01463-20UG
50 ug
£264.00
RP01463-50UG
100 ug
£395.00
RP01463-100UG
About this Product
- SKU:
- RP01463
- Additional Names:
- Sep2,Alp-1,Ltw-1,Sep-1,Sep-2,Apoa-1,Brp-14,Lvtw-1,apo-AI,apoA-I,APOA1
- Extra Details:
- Recombinant Mouse Apolipoprotein A-I/APOA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp25-Gln264) of mouse ApoA-I/APOA1 (Accession #NP_033822.2) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Asp25-Gln264
- Molecular Weight:
- 53.91 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01463
