Recombinant Mouse Apolipoprotein A-I/APOA1 Protein
Product Sizes
10 ug
£145.00
RP01463-10UG
20 ug
£193.00
RP01463-20UG
50 ug
£264.00
RP01463-50UG
100 ug
£395.00
RP01463-100UG
500 ug
£1157.00
RP01463-500UG
1000 ug
£1812.00
RP01463-1000UG
About this Product
- SKU:
- RP01463
- Additional Names:
- Sep2,Alp-1,Ltw-1,Sep-1,Sep-2,Apoa-1,Brp-14,Lvtw-1,apo-AI,apoA-I,APOA1
- Extra Details:
- Apolipoprotein A1 (APOA1) is a member of the apolipoprotein family whose members are proteins bind with lipids and form lipoproteins to translate these oil-soluble lipids such as fat and cholesterol through lymphatic and circulatory system. APOA1 is the main component of high density lipoprotein (HDL) in plasma and is involved in the esterification of cholesterol as a cofactor of lecithin-cholesterol acyltransferase (LCAT) which is responsible for the formation of most plasma cholesteryl esters, and thus play a major role in cholesterol efflux from peripheral cells. As a major component of the HDL complex, APOA1 helps to clear cholesterol from arteries. APOA1 is also characterized as a prostacyclin stabilizing factor, and thus may have an anticlotting effect. Defects in encoding gene may result in HDL deficiencies, including Tangier disease, and with systemic non-neuropathic amyloidosis. Men carrying a mutation may develop premature coronary artery disease.
- Formulation:
- Recombinant Mouse Apolipoprotein A-I/APOA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp25-Gln264) of mouse ApoA-I/APOA1 (Accession #NP_0338
- Immunogen:
- Asp25-Gln264
- Molecular Weight:
- 60-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DEPQSQWDKVKDFANVYVDAVKDSGRDYVSQFESSSLGQQLNLNLLENWDTLGSTVSQLQERLGPLTRDFWDNLEKETDWVRQEMNKDLEEVKQKVQPYLDEFQKKWKEDVELYRQKVAPLGAELQESARQKLQELQGRLSPVAEEFRDRMRTHVDSLRTQLAPHSEQMRESLAQRLAELKSNPTLNEYHTRAKTHLKTLGEKARPALEDLRHSLMPMLETLKTQVQSVIDKASETLTAQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01463


