Recombinant Mouse IL-17A/CTLA-8 Protein
Product Sizes
10 ug
£145.00
RP01460-10UG
20 ug
£193.00
RP01460-20UG
50 ug
£288.00
RP01460-50UG
100 ug
£431.00
RP01460-100UG
500 ug
£1240.00
RP01460-500UG
1000 ug
£1954.00
RP01460-1000UG
About this Product
- SKU:
- RP01460
- Additional Names:
- Il17,Ctla8,IL-17,Ctla-8,IL17A,IL-17A
- Extra Details:
- IL17, also known as IL17a, is a cytokine that belongs to the IL-17 family. Cytokines are proteinaceous signaling compounds that are major mediators of the immune response. They control many different cellular functions including proliferation, differentiation, and cell survival/apoptosis but are also involved in several pathophysiological processes including viral infections and autoimmune diseases. Cytokines are synthesized under various stimuli by a variety of cells of both the innate (monocytes, macrophages, dendritic cells) and adaptive (T- and B-cells) immune systems. The IL-17 family of cytokines includes six members, IL-17/IL-17A, IL-17B, IL-17C, IL-17D, IL-17E/IL-25, and IL-17F, which are produced by multiple cell types. IL-17 regulates the activities of NF-kappaB and mitogen-activated protein kinases. This cytokine can stimulate the expression of IL6 and cyclooxygenase-2 (PTGS2/COX-2), as well as enhance the production of nitric oxide (NO). High levels of IL-17 are associated with several chronic inflammatory diseases including rheumatoid arthritis, psoriasis, and multiple sclerosis.
- Formulation:
- Recombinant Mouse IL-17A/CTLA-8 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala26-Ala158) of mouse IL-17A/CTLA-8 (Accession #NP_034682.1.) fus
- Immunogen:
- Ala26-Ala158
- Molecular Weight:
- 16-24 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- AAIIPQSSACPNTEAKDFLQNVKVNLKVFNSLGAKVSSRRPSDYLNRSTSPWTLHRNEDPDRYPSVIWEAQCRHQRCVNAEGKLDHHMNSVLIQQEILVLKREPESCPFTFRVEKMLVGVGCTCVASIVRQAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01460
