Recombinant Human Mature TGF-beta 1 Protein
Product Sizes
10 ug
£145.00
RP01458-10UG
20 ug
£193.00
RP01458-20UG
50 ug
£288.00
RP01458-50UG
100 ug
£431.00
RP01458-100UG
500 ug
£1240.00
RP01458-500UG
1000 ug
£1954.00
RP01458-1000UG
About this Product
- SKU:
- RP01458
- Additional Names:
- TGFB1, CED, DPD1, LAP, TGFB, TGFbeta, transforming growth factor beta-1,TGF-beta 1,CED,DPD1,LAP,TGFB,TGFbeta,TGF-B Beta
- Extra Details:
- TGF-beta 1 is a member of the transforming growth factor beta (TGF-beta) family. The transforming growth factor-beta family of polypeptides are involved in the regulation of cellular processes, including cell division, differentiation, motility, adhesion and death. TGF-beta 1 positively and negatively regulates many other growth factors. It inhibits the secretion and activity of many other cytokines including interferon-G Gamma, tumor necrosis factor-alpha and various interleukins. It can also decrease the expression levels of cytokine receptors. Meanwhile, TGF-beta 1 also increases the expression of certain cytokines in T cells and promotes their proliferation, particularly if the cells are immature. TGF-beta 1 also inhibits proliferation and stimulates apoptosis of B cells, and plays a role in controlling the expression of antibody, transferrin and MHC class II proteins on immature and mature B cells. As for myeloid cells, TGF-beta 1can inhibit their proliferation and prevent their production of reactive oxygen and nitrogen intermediates. However, as with other cell types, TGF-beta 1 also has the opposite effect on cells of myeloid origin. TGF-beta 1 is a multifunctional protein that controls proliferation, differentiation and other functions in many cell types. It plays an important role in bone remodeling as it is a potent stimulator of osteoblastic bone formation, causing chemotaxis, proliferation and differentiation in committed osteoblasts. Once cells lose their sensitivity to TGF-beta1-mediated growth inhibition, autocrine TGF-beta signaling can promote tumorigenesis. Elevated levels of TGF-beta1 are often observed in advanced carcinomas, and have been correlated with increased tumor invasiveness and disease progression.
- Formulation:
- Recombinant Human Mature TGF-beta 1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala279-Ser390) of human Mature TGF-beta 1 (Accession #NP_00065
- Immunogen:
- Ala279-Ser390
- Molecular Weight:
- 15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01458
