Recombinant Human Mature TGF-beta 1 Protein
Product Sizes
10 ug
£145.00
RP01458-10UG
20 ug
£193.00
RP01458-20UG
50 ug
£288.00
RP01458-50UG
100 ug
£431.00
RP01458-100UG
About this Product
- SKU:
- RP01458
- Additional Names:
- TGFB1, CED, DPD1, LAP, TGFB, TGFbeta, transforming growth factor beta-1,TGF-beta 1,CED,DPD1,LAP,TGFB,TGFbeta,TGF-B Beta
- Extra Details:
- Recombinant Human Mature TGF-beta 1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala279-Ser390) of human Mature TGF-beta 1 (Accession #NP_000651.3) fused with no tag.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of 50 mM Glycine,150 mM NaCl,pH3.5.
- Immunogen:
- Ala279-Ser390
- Molecular Weight:
- 12.79 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALDTNYCFSSTEKNCCVRQLYIDFRKDLGWKWIHEPKGYHANFCLGPCPYIWSLDTQYSKVLALYNQHNPGASAAPCCVPQALEPLPIVYYVGRKPKVEQLSNMIVRSCKCS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01458










