Recombinant Human LILRA6/ILT-8/CD85b Protein
Product Sizes
10 ug
£133.00
RP01453-10UG
20 ug
£181.00
RP01453-20UG
50 ug
£240.00
RP01453-50UG
100 ug
£353.00
RP01453-100UG
500 ug
£1002.00
RP01453-500UG
1000 ug
£1574.00
RP01453-1000UG
About this Product
- SKU:
- RP01453
- Additional Names:
- ILT5,ILT8,CD85b,ILT-8,LILRB3,LILRB6,LILRA6
- Extra Details:
- The LILRs are a family of receptors that regulate the activities of myelomonocytic cells. LILRB3 and LILRA6 represent a pair of inhibitory/activating receptors with identical extracellular domains and unknown ligands. LILRB3 (ILT5) and LILRA6 (ILT8) are highly polymorphic receptors with similar extracellular domains. LILRA6 can signal through association with an activating adaptor molecule, FcRG Gamma, which bears a cytoplasmic tail with an immunoreceptor tyrosine-based activation motif. Analysis of mRNA expression in the major fractions of PBMCs showed that LILRA6 is primarily expressed in monocytes, and its expression level correlates with copy number of the gene.
- Formulation:
- Recombinant Human LILRA6/ILT-8/CD85b Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly24-Asn447) of human LILRA6/CD85b/ILT8 (Accession #CCDS4261
- Immunogen:
- Gly24-Asn447
- Molecular Weight:
- 65-75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GPFPKPTLWAEPGSVISWGSPVTIWCQGSLEAQEYQLDKEGSPEPLDRNNPLEPKNKARFSIPSMTQHHAGRYRCHYYSSAGWSEPSDPLELVMTGFYNKPTLSALPSPVVASGGNMTLRCGSQKGYHHFVLMKEGEHQLPRTLDSQQLHSGGFQALFPVGPVTPSHRWRFTCYYYYTNTPRVWSHPSDPLEILPSGVSRKPSLLTLQGPVLAPGQSLTLQCGSDVGYDRFVLYKEGERDFLQRPGQQPQAGLSQANFTLGPVSPSHGGQYRCYGAHNLSSEWSAPSDPLNILMAGQIYDTVSLSAQPGPTVASGENVTLLCQSRGYFDTFLLTKEGAAHPPLRLRSMYGAHKYQAEFPMSPVTSAHAGTYRCYGSYSSNPHLLSFPSEPLELMVSGHSGGSSLPPTGPPSTPASHAKDYTVEN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01453
