Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein
Product Sizes
10 ug
£133.00
RP01452-10UG
20 ug
£181.00
RP01452-20UG
50 ug
£240.00
RP01452-50UG
100 ug
£353.00
RP01452-100UG
500 ug
£1002.00
RP01452-500UG
1000 ug
£1574.00
RP01452-1000UG
About this Product
- SKU:
- RP01452
- Additional Names:
- KIR2DL2,CD158B1,CD158b,NKAT-6,NKAT6,p58.2
- Extra Details:
- KIR2DL2 (2DL2, formerly NKAT6, designated CD158b) is a 348 amino acid (aa) type I transmembrane glycoprotein that belongs to the human killer cell Ig?like receptor (KIR) family. KIRs are expressed on human CD56dim NK cells and T cell subsets, and regulate effector functions in the innate immune system.KIR2DL2 is receptor on natural killer (NK) cells for HLA-Cw1, 3, 7, and 8 allotypes. Inhibits the activity of NK cells thus preventing cell lysis.
- Formulation:
- Recombinant Human NKAT-6/KIR2DL2/CD158b1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL2 (Accession #NP_055034.2) f
- Immunogen:
- His22-His245
- Molecular Weight:
- 40-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HEGVHRKPSLLAHPGRLVKSEETVILQCWSDVRFEHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHECRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVIGNPSNSWPSPTEPSSKTGNPRHLH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01452
