Recombinant Mouse TROP-2/TACSTD2 Protein
Product Sizes
10 ug
£127.00
RP01449-10UG
20 ug
£157.00
RP01449-20UG
50 ug
£223.00
RP01449-50UG
100 ug
£336.00
RP01449-100UG
About this Product
- SKU:
- RP01449
- Additional Names:
- Ly97,EGP-1,TROP2,C80403,GA733-1,Trop2
- Extra Details:
- Recombinant Mouse TROP-2/TACSTD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln25-Gly270) of mouse TROP-2/TACSTD2 (Accession #NP_064431.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln25-Gly270
- Molecular Weight:
- 28.84 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QSNCTCPTNKMTVCDTNGPGGVCQCRAMGSQVLVDCSTLTSKCLLLKARMSARKSGRSLVMPSEHAILDNDGLYDPECDDKGRFKARQCNQTSVCWCVNSVGVRRTDKGDQSLRCDEVVRTHHILIELRHRPTDRAFNHSDLDSELRRLFQERYKLHPSFLSAVHYEEPTIQIELRQNASQKGLRDVDIADAAYYFERDIKGESLFMGRRGLDVQVRGEPLHVERTLIYYLDEKPPQFSMKRLTAG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01449




