Recombinant Human TNFSF12/TWEAK Protein

Product Sizes

10 ug

£145.00

RP01446-10UG

20 ug

£193.00

RP01446-20UG

50 ug

£288.00

RP01446-50UG

100 ug

£431.00

RP01446-100UG

500 ug

£1240.00

RP01446-500UG

1000 ug

£1954.00

RP01446-1000UG

About this Product

SKU:: RP01446
Additional Names:: TNFSF12,APO3L,DR3LG,TNLG4A,TWEAK
Extra Details:: TNFSF12 is a cytokine that belongs to the tumor necrosis factor (TNF) ligand family. It is a ligand for the FN14/TWEAKR receptor. TNFSF12 has overlapping signaling functions with TNF, but displays a much wider tissue distribution. It can induce apoptosis via multiple pathways of cell death in a cell type-specific manner. It is also found that TNFSF12 promotes proliferation and migration of endothelial cells, and thus acts as a regulator of angiogenesis. TNFSF12 also is a weak inducer of apoptosis in some cell types and mediates NF-kappa-B activation.
Formulation:: Recombinant Human TNFSF12/TWEAK Protein is produced by E. coli expression system. The target protein is expressed with sequence (Lys97-His249 (N-Met)) of human TWEAK/TNFSF12 (Accession #NP_003800.1) f
Immunogen:: Lys97-His249 (N-Met)
Molecular Weight:: 15-20 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: KGRKTRARRAIAAHYEVHPRPGQDGAQAGVDGTVSGWEEARINSSSPLRYNRQIGEFIVTRAGLYYLYCQVHFDEGKAVYLKLDLLVDGVLALRCLEEFSATAASSLGPQLRLCQVSGLLALRPGSSLRIRTLPWAHLKAAPFLTYFGLFQVH
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket