Recombinant Human Apolipoprotein A-II/APOA2 Protein
Product Sizes
10 ug
£145.00
RP01441-10UG
20 ug
£193.00
RP01441-20UG
50 ug
£288.00
RP01441-50UG
100 ug
£431.00
RP01441-100UG
500 ug
£1240.00
RP01441-500UG
1000 ug
£1954.00
RP01441-1000UG
About this Product
- SKU:
- RP01441
- Additional Names:
- APOA2,Apo-AII,ApoA-II,apoAII, ApoA-II, apoAII
- Extra Details:
- Apolipoprotein A-II(Apo-AII for short), also known as Apolipoprotein A2, is a secreted protein which belongs to the apolipoprotein A2 family. It exists as a disulfide-linked homodimer; and also can form a disulfide- linked heterodimer with APOD. APOA2 is the 2nd most abundant protein of the high density lipoprotein particles. This protein may stabilize HDL (high density lipoprotein) structure by its association with lipids, and affect the HDL metabolism. Defects in APOA2 gene might cause apolipoprotein A-II deficiency or hypercholesterolemia.
- Formulation:
- Recombinant Human Apolipoprotein A-II/APOA2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala19-Gln100) of human Apolipoprotein A-II/APOA2 (Acce
- Immunogen:
- Ala19-Gln100
- Molecular Weight:
- 45-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALVRRQAKEPCVESLVSQYFQTVTDYGKDLMEKVKSPELQAEAKSYFEKSKEQLTPLIKKAGTELVNFLSYFVELGTQPATQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01441
