Recombinant Human IFN-alpha 2 Protein
Product Sizes
10 ug
£107.00
RP01432-10UG
20 ug
£133.00
RP01432-20UG
50 ug
£163.00
RP01432-50UG
100 ug
£240.00
RP01432-100UG
500 ug
£645.00
RP01432-500UG
1000 ug
£1002.00
RP01432-1000UG
About this Product
- SKU:
- RP01432
- Additional Names:
- IFNA2, IFN-alphaA, IFNA, IFNA2B, INFA2, interferon alpha-2,Interferon alpha 2 (IFN-A Alpha2) ,IFN-alphaA,IFNA,IFNA2B,INFA2
- Extra Details:
- IFNA2 (Interferon Alpha 2) is a Protein Coding gene. This gene is a member of the alpha interferon gene cluster on chromosome 9. The encoded protein is a cytokine produced in response to viral infection. Type I Interferons (IFNs) are well-known cytokines that exert antiviral activity, antitumor activity, and immunomodulatory effects. Interferon tau (IFNT), a type I IFN similar to alpha IFNs (IFNA), is the pregnancy recognition signal produced by the ruminant conceptus. Among the IFN-A Alpha genes, a total of 28 different sequence variants have been described. The three principal subtypes of IFNA Alpha-2 are designated A Alpha-2a, A Alpha-2b, and A Alpha-2c. IFNA Alpha-2b is being the predominant allele while IFNA Alpha-2a is less predominant and IFNA Alpha-2c only a minor allelic variant.
- Formulation:
- Recombinant Human IFN-alpha 2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Cys24-Glu188) of human Interferon alpha 2/IFNA2 (Accession #NP_00059
- Immunogen:
- Cys24-Glu188
- Molecular Weight:
- 20-23 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDFGFPQEEFGNQFQKAETIPVLHEMIQQIFNLFSTKDSSAAWDETLLDKFYTELYQQLNDLEACVIQGVGVTETPLMKEDSILAVRKYFQRITLYLKEKKYSPCAWEVVRAEIMRSFSLSTNLQESLRSKE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01432
