Recombinant Human NKAT-1/KIR2DL1/CD158a Protein
Product Sizes
10 ug
£133.00
RP01431-10UG
20 ug
£181.00
RP01431-20UG
50 ug
£240.00
RP01431-50UG
100 ug
£353.00
RP01431-100UG
500 ug
£1002.00
RP01431-500UG
1000 ug
£1574.00
RP01431-1000UG
About this Product
- SKU:
- RP01431
- Additional Names:
- KIR2DL1,CD158A,KIR-K64,KIR221,NKAT,NKAT-1,NKAT1,p58.1
- Extra Details:
- Killer cell immunoglobulin-like receptor 2DL1 or KIR2DL1 is an inhibitory Natural Killer cell immunoglobulin-like receptor with two extracellular immunoglobulin domains. KIR2DL1 is a member of the Killer cell immunoglobulin-like receptor family whose members are classified by the number of the extracellular immunoglobulin domains and the length of the cytoplasm domain. KIR2DL1 is a transmembrane glycoprotein expressed by natural killer cells and subsets of T cells. KIR2DL1 down-regulates the cytotoxicity of NK cells upon recognition of specific class I major histocompatibility complex (MHC) molecules on target cells. It has been reported that the KIR2DL1 is bound to its class I MHC ligand, HLA-Cw4. The KIR2DL1-HLA-Cw4 interface exhibits charge and shape complementarity. Specificity is mediated by a pocket in KIR2DL1 that hosts the Lys80 residue of HLA-Cw4. Many residues conserved in HLA-C and KIR2DL receptors make different interactions in KIR2DL1-HLA-Cw4 and a previously reported KIR2DL2-HLA-Cw3 complex. A dimeric aggregate of KIR-HLA-C complexes was observed in one KIR2DL1-HLA-Cw4 crystal.
- Formulation:
- Recombinant Human NKAT-1/KIR2DL1/CD158a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-Arg242) of human KIR2DL1 (Accession #NP_055033.2) fu
- Immunogen:
- His22-Arg242
- Molecular Weight:
- 38-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01431
