Recombinant Human NKAT-1/KIR2DL1/CD158a Protein
Product Sizes
10 ug
£133.00
RP01431-10UG
20 ug
£181.00
RP01431-20UG
50 ug
£240.00
RP01431-50UG
100 ug
£353.00
RP01431-100UG
About this Product
- SKU:
- RP01431
- Additional Names:
- KIR2DL1,CD158A,KIR-K64,KIR221,NKAT,NKAT-1,NKAT1,p58.1
- Extra Details:
- Recombinant Human NKAT-1/KIR2DL1/CD158a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-Arg242) of human KIR2DL1 (Accession #NP_055033.2) fused with a 6xHis, Avi tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- His22-Arg242
- Molecular Weight:
- 26.87 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVMFEHFLLHREGMFNDTLRLIGEHHDGVSKANFSISRMTQDLAGTYRCYGSVTHSPYQVSAPSDPLDIVIIGLYEKPSLSAQPGPTVLAGENVTLSCSSRSSYDMYHLSREGEAHERRLPAGPKVNGTFQADFPLGPATHGGTYRCFGSFHDSPYEWSKSSDPLLVSVTGNPSNSWPSPTEPSSKTGNPR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01431
