Recombinant Human VEGF-D/FIGF Protein
Product Sizes
10 ug
£133.00
RP01426-10UG
20 ug
£181.00
RP01426-20UG
50 ug
£240.00
RP01426-50UG
100 ug
£353.00
RP01426-100UG
About this Product
- SKU:
- RP01426
- Additional Names:
- VEGFD, FIGF, VEGF-D, vascular endothelial growth factor D,FIGF,VEGF-D
- Extra Details:
- Recombinant Human VEGF-D/FIGF Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe93-Ser201) of human VEGF-D/FIGF (Accession #NP_004460.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Phe93-Ser201
- Molecular Weight:
- 13.02 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FYDIETLKVIDEEWQRTQCSPRETCVEVASELGKSTNTFFKPPCVNVFRCGGCCNEESLICMNTSTSYISKQLFEISVPLTSVPELVPVKVANHTGCKCLPTAPRHPYS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01426








