Recombinant Cynomolgus IL-2RG/CD132 Protein
Product Sizes
10 ug
£127.00
RP01424-10UG
20 ug
£175.00
RP01424-20UG
50 ug
£240.00
RP01424-50UG
100 ug
£336.00
RP01424-100UG
500 ug
£1002.00
RP01424-500UG
1000 ug
£1574.00
RP01424-1000UG
About this Product
- SKU:
- RP01424
- Additional Names:
- IL2RG,CD132,CIDX,IMD4,P64,SCIDX,SCIDX1,gammaC,IL2RG
- Extra Details:
- The common gamma chain (G Gammac) (or CD132), also known as interleukin-2 receptor subunit gamma or IL2RG, is a member of the type I cytokine receptor family expressed on most lymphocyte (white blood cell) populations, and its gene is found on the X-chromosome of mammals. The common gamma chain (G Gammac) (or IL2RG), is a cytokine receptor subunit that is common to the receptor complexes for at least six different interleukin receptors: IL-2, IL-4, IL-7, IL-9, IL-15, and the interleukin-21 receptor. It is a component of multiple cytokine receptors that are essential for lymphocyte development and function. X-linked severe combined immunodeficiency (X-SCID) is a rare and potentially fatal disease caused by mutations of IL2RG, the gene encoding IL2RG. IL2RG was demonstrated to be a component of the IL-4 receptor based on chemical cross-linking data, the ability of IL2RG to augment IL-4 binding affinity. The observation that IL-2R gamma is a functional component of the IL-4 receptor, together with the finding that IL-2R gamma associates with the IL-7 receptor, begins to elucidate why a deficiency of this common gamma chain (gamma c) has a profound effect on lymphoid function and development, as seen in X-linked severe combined immunodeficiency.
- Formulation:
- Recombinant Cynomolgus IL-2RG/CD132 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu23-Asn254) of cynomolgus (rhesus macaque) IL-2 R gamma/CD1
- Immunogen:
- Leu23-Asn254
- Molecular Weight:
- 70-100 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LNTTILTPNGNEDATTDFFLTSMPTDSLSVSTLPLPEVQCFVFNVEYMNCTWNSSSEPQPTNLTLHYWYKNSDNDKVQKCSHYLFSEEITSGCQLQEKEIHLYQTFVVQLQDPREPRRQATQMLKLQNLVIPWAPENLTLRKLSESQLELNWNNRFLNHCLEHLVQYRTDWDHSWTEQSVDYRHKFSLPSVDGQKRYTFRVRSRFNPLCGSAQHWSEWSHPIHWGSNSSKEN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01424
