Recombinant Human Frizzled-2/FZD2 Protein
Product Sizes
10 ug
£133.00
RP01422-10UG
50 ug
£240.00
RP01422-50UG
100 ug
£353.00
RP01422-100UG
500 ug
£1002.00
RP01422-500UG
1000 ug
£1574.00
RP01422-1000UG
About this Product
- SKU:
- RP01422
- Additional Names:
- Fz2, fz-2, fzE2, hFz2, OMOD2,FZD2
- Extra Details:
- Frizzled-2 (FZD2) is also known as FzE2, which belongs to the G-protein coupled receptor Fz/Smo family. Most of frizzled receptors are coupled to the beta-catenin canonical signaling pathway, which leads to the activation of disheveled proteins, inhibition of GSK-3 kinase, nuclear accumulation of beta-catenin and activation of Wnt target genes. FZD2 contains one FZ (frizzled) domain. FZD2 may be involved in transduction and intercellular transmission of polarity information during tissue morphogenesis and/or in differentiated tissues. The Lys-Thr-X-X-X-Trp motif of FZD2 interacts with the PDZ doman of Dvl (Disheveled) family members and is involved in the activation of the Wnt/beta-catenin signaling pathway.
- Formulation:
- Recombinant Human Frizzled-2/FZD2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln24-Leu163) of human Frizzled-2/FZD2 (Accession #NP_001457.1)
- Immunogen:
- Gln24-Leu163
- Molecular Weight:
- 50-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QFHGEKGISIPDHGFCQPISIPLCTDIAYNQTIMPNLLGHTNQEDAGLEVHQFYPLVKVQCSPELRFFLCSMYAPVCTVLEQAIPPCRSICERARQGCEALMNKFGFQWPERLRCEHFPRHGAEQICVGQNHSEDGAPAL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01422
