Recombinant Human BMPR-2 Protein
Product Sizes
10 ug
£127.00
RP01420-10UG
20 ug
£157.00
RP01420-20UG
50 ug
£223.00
RP01420-50UG
100 ug
£336.00
RP01420-100UG
About this Product
- SKU:
- RP01420
- Additional Names:
- BMPR2, BMPR-II, BMPR3, BMR2, BRK-3, POVD1, PPH1, T-ALK, bone morphogenetic protein receptor type-2,BMPR-II,BMPR3,BMR2,BRK-3,POVD1,PPH1,T-ALK
- Extra Details:
- Recombinant Human BMPR-2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser27-Ile151) of human BMPR2 (Accession #NP_001195.2) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser27-Ile151
- Molecular Weight:
- 39.97 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SQNQERLCAFKDPYQQDLGIGESRISHENGTILCSKGSTCYGLWEKSKGDINLVKQGCWSHIGDPQECHYEECVVTTTPPSIQNGTYRFCCCSTDLCNVNFTENFPPPDTTPLSPPHSFNRDETI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Enzymes
- Manufacturer's Data Sheet:RP01420
