Recombinant Human Ephrin-A1/EFNA1 Protein
Product Sizes
50 ug
£240.00
RP01419-50UG
100 ug
£353.00
RP01419-100UG
500 ug
£1002.00
RP01419-500UG
1000 ug
£1574.00
RP01419-1000UG
About this Product
- SKU:
- RP01419
- Additional Names:
- B61, ECKLG, EFL1, EPLG1, LERK-1, LERK1, TNFAIP4,EFNA1,ECKLG,EFL1,EPLG1,LERK-1,LERK1,TNFAIP4,ephrin-A1
- Extra Details:
- EPH-related receptor tyrosine kinase ligand 1 (abbreviated as Ephrin-A1) also known as ligand of eph-related kinase 1 or EFNA1, is a member of the ephrin (EPH) family. The Eph family receptor interacting proteins (ephrins) are a family of proteins that serve as the ligands of the Eph receptor, which compose the largest known subfamily of receptor protein-tyrosine kinases (RTKs). Ephrin-A1/EFNA1 and its Eph family of receptor tyrosine kinases are expressed by cells of the SVZ. Ephrin subclasses are further distinguished by their mode of attachment to the plasma membrane: ephrin-A ligands bind EphA receptors and are anchored to the plasma membrane via a glycosylphosphatidylinositol (GPI) linkage, whereas ephrin-B ligands bind EphB receptors and are anchored via a transmembrane domain. An exception is the EphA4 receptor, which binds both subclasses of ephrins. Ephrin-A1 and one of its receptor EphA2 were expressed in xenograft endothelial cells and also tumor cells and play a role in human cancers, at least in part by influencing tumor neovascularization.
- Formulation:
- Recombinant Human Ephrin-A1/EFNA1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp19-Ser182) of human Ephrin-A1/EFNA1 (Accession #NP_004419.2)
- Immunogen:
- Asp19-Ser182
- Molecular Weight:
- 26 kDa kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DRHTVFWNSSNPKFRNEDYTIHVQLNDYVDIICPHYEDHSVADAAMEQYILYLVEHEEYQLCQPQSKDQVRWQCNRPSAKHGPEKLSEKFQRFTPFTLGKEFKEGHSYYYISKPIHQHEDRCLRLKVTVSGKITHSPQAHDNPQEKRLAADDPEVRVLHSIGHS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01419
