Recombinant Human MUC-16/CA125 Protein
Product Sizes
10 ug
£133.00
RP01417-10UG
20 ug
£181.00
RP01417-20UG
50 ug
£240.00
RP01417-50UG
100 ug
£353.00
RP01417-100UG
500 ug
£1002.00
RP01417-500UG
1000 ug
£1574.00
RP01417-1000UG
About this Product
- SKU:
- RP01417
- Additional Names:
- CA125,MUC16,mucin-16
- Extra Details:
- The CA125, also known as the MUC16, is a mucin protein that may be found in type I transmembrane or secreted forms that are used monitor the progress of epithelial ovarian cancer therapy. The CA 125 molecule is almost certainly a glycoprotein with a predominance of O-linkages. It is heterogeneous with regard to both size and charge, most likely due to continuous deglycosylation of side chains during its life-span in bodily fluids. It exists as a very large complex (perhaps as much as 4 million daltons) under natural conditions.
- Formulation:
- Recombinant Human MUC-16/CA125 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly12660-Met12923) of human CA125/MUC16 (Accession #NP_078966.2) fu
- Immunogen:
- Gly12660-Met12923
- Molecular Weight:
- 45-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GFTHWIPVPTSSTPGTSTVDLGSGTPSSLPSPTTAGPLLVPFTLNFTITNLKYEEDMHCPGSRKFNTTERVLQSLLGPMFKNTSVGPLYSGCRLTLLRSEKDGAATGVDAICTHRLDPKSPGVDREQLYWELSQLTNGIKELGPYTLDRNSLYVNGFTHQTSAPNTSTPGTSTVDLGTSGTPSSLPSPTSAGPLLVPFTLNFTITNLQYEEDMHHPGSRKFNTTERVLQGLLGPMFKNTSVGLLYSGCRLTLLRPEKNGAATGM
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01417
