Recombinant Mouse Complement C3 Protein
Product Sizes
100 ug
£395.00
RP01415-100UG
About this Product
- SKU:
- RP01415
- Additional Names:
- C3,AHUS5,ARMD9,ASP,C3a,C3b,CPAMD1,HEL-S-62p,complement C3,C3 / C3a
- Extra Details:
- Recombinant Mouse Complement C3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser671-Arg748) of mouse Complement component 3 (Accession #NP_033908.2) fused with a 6xHis, Avi tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser671-Arg748
- Molecular Weight:
- 11.87 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01415
