Recombinant Mouse Complement C3 Protein
Product Sizes
50 ug
£288.00
RP01415-50UG
100 ug
£395.00
RP01415-100UG
500 ug
£1157.00
RP01415-500UG
1000 ug
£1812.00
RP01415-1000UG
About this Product
- SKU:
- RP01415
- Additional Names:
- C3,AHUS5,ARMD9,ASP,C3a,C3b,CPAMD1,HEL-S-62p,complement C3,C3 / C3a
- Extra Details:
- C3 is the major complement component serum. It is mainly synthesized by macrophages and liver. C3 plays a central role in the activation of the complement system. Its processing by C3 convertase is the central reaction in both classical and alternative complement pathways. It is cleaved into two fragments, C3a and C3b. C3a anaphylatoxin is a mediator of local inflammatory process. In chronic inflammation, acts as a chemoattractant for neutrophils. After activation C3b can bind covalently, via its reactive thioester, to cell surface carbohydrates or immune aggregates. It induces the contraction of smooth muscle, increases vascular permeability and causes histamine release from mast cells and basophilic leukocytes.
- Formulation:
- Recombinant Mouse Complement C3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser671-Arg748) of mouse Complement component 3 (Accession #NP_0339
- Immunogen:
- Ser671-Arg748
- Molecular Weight:
- 15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01415
