Recombinant Human Fibronectin/CIG/FN1 Protein
Product Sizes
20 ug
£133.00
RP01414-20UG
50 ug
£163.00
RP01414-50UG
100 ug
£240.00
RP01414-100UG
About this Product
- SKU:
- RP01414
- Additional Names:
- FN1,CIG,ED-B,FINC,FN,FNZ,GFND,GFND2,LETS,MSF,fibronectin
- Extra Details:
- Recombinant Human Fibronectin/CIG/FN1 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asn1722-Thr1811) of human Fibronectin (Accession #NP_997647.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Asn1722-Thr1811
- Molecular Weight:
- 10.70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- NIDRPKGLAFTDVDVDSIKIAWESPQGQVSRYRVTYSSPEDGIHELFPAPDGEEDTAELQGLRPGSEYTVSVVALHDDMESQPLIGTQST
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01414
