Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein
Product Sizes
10 ug
£133.00
RP01412-10UG
20 ug
£181.00
RP01412-20UG
50 ug
£240.00
RP01412-50UG
100 ug
£353.00
RP01412-100UG
500 ug
£1002.00
RP01412-500UG
1000 ug
£1574.00
RP01412-1000UG
About this Product
- SKU:
- RP01412
- Additional Names:
- TNFRSF1A,CD120a,FPF,TBP1,TNF-R,TNF-R-I,TNF-R55,TNFAR,TNFR1,TNFR55,TNFR60,p55,p55-R,p60
- Extra Details:
- The cluster of differentiation (CD) system is commonly used as cell markers in Immunophenotyping. Different kinds of cells in the immune system can be identified through the surface CD molecules which associating with the immune function of the cell. There are more than 320 CD unique clusters and subclusters have been identified. Some of the CD molecules serve as receptors or ligands important to the cell through initiating a signal cascade which then alter the behavior of the cell. Some CD proteins do not take part in cell signal process but have other functions such as cell adhesion. CD120a (cluste of differentiation 120a), also known as TNFR1 / TNFRSF1A, is a member of CD family, tumor necrosis factor receptor superfamily. CD120a is one of the most primary receptors for the tumor necrosis factor-alpha. It has been shown to be localized to both plasma membrane lipid rafts and the trans golgi complex with the help of the death domain (DD). CD120a can activate the transcription factor NF-K KappaB, mediate apoptosis, and regulate inflammation processes.
- Formulation:
- Recombinant Human TNFRSF1A/TNF-R1/CD120a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu30-Thr211) of human CD120a/TNFRSF1A (Accession #NP_001
- Immunogen:
- Leu30-Thr211
- Molecular Weight:
- 55-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- LVPHLGDREKRDSVCPQGKYIHPQNNSICCTKCHKGTYLYNDCPGPGQDTDCRECESGSFTASENHLRHCLSCSKCRKEMGQVEISSCTVDRDTVCGCRKNQYRHYWSENLFQCFNCSLCLNGTVHLSCQEKQNTVCTCHAGFFLRENECVSCSNCKKSLECTKLCLPQIENVKGTEDSGTT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01412


