Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein
Product Sizes
10 ug
£133.00
RP01403-10UG
20 ug
£181.00
RP01403-20UG
50 ug
£240.00
RP01403-50UG
100 ug
£353.00
RP01403-100UG
500 ug
£1002.00
RP01403-500UG
1000 ug
£1574.00
RP01403-1000UG
About this Product
- SKU:
- RP01403
- Additional Names:
- CXCL3,CINC-2b,GRO3,GROg,MIP-2b,MIP2B,SCYB3
- Extra Details:
- CXCL3 is involved in migration, invasion, proliferation and tubule formation of trophoblasts and may play a key role in the pathogenesis of preeclampsia. CXCL3 autocrine/paracrine pathways are involved in the development of prostate cancer by regulating the expression of the target genes that are related to the progression of malignancies. CXCL3 is a novel adipokine that facilitates adipogenesis in an autocrine and/or a paracrine manner through induction of c/ebpb and c/ebpd. CXCL3 and its receptor CXCR2 are overexpressed in prostate cancer cells, prostate epithelial cells and prostate cancer tissues, which may play multiple roles in prostate cancer progression and metastasis.
- Formulation:
- Recombinant Human CXCL3/GRO-gamma/MIP2-beta Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala35-Asn107) of human CXCL3/GRO gamma (Accession #NP_00208
- Immunogen:
- Ala35-Asn107
- Molecular Weight:
- 10-15 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥85%
- Sequence:
- ASVVTELRCQCLQTLQGIHLKNIQSVNVRSPGPHCAQTEVIATLKNGKKACLNPASPMVQKIIEKILNKGSTN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01403
