Recombinant Human ICOS/CD278 Protein
Product Sizes
10 ug
£133.00
RP01401-10UG
20 ug
£181.00
RP01401-20UG
50 ug
£240.00
RP01401-50UG
100 ug
£353.00
RP01401-100UG
500 ug
£1002.00
RP01401-500UG
1000 ug
£1574.00
RP01401-1000UG
About this Product
- SKU:
- RP01401
- Additional Names:
- AILIM, CD278, CVID1,ICOS,CD278,CVID1
- Extra Details:
- Inducible costimulator (ICOS), also called AILIM (Activation-Inducible Lymphocyte Immunomediatory Molecule) is a cell-surface receptor and belongs to the CD28 family of immune costimulatory receptors consisting of CD28, CTLA-4, and PD-1. The interaction of B7-H2/ICOS plays a critical role in Th cell differentiation, T?B cell interactions which are essential for the germinal center formation, and humoral immune responses, and as well as the production of cytokine IL-4. Also, ICOS is more potent in the induction of IL-10 production, a cytokine important for the suppressive function of T regulatory cells. The B7-1/B7-2--CD28/CTLA-4 and ICOS-B7RP-1 pathway provide key second signals that can regulate the activation, inhibition, and fine-tuning of T-lymphocyte responses. ICOS stimulates both Th1 and Th2 cytokine production but may have a preferential role in Th2 cell development. Moreover, The B7-1/B7-2-CD28/CTLA-4 and ICOS-B7RP-1 pathway has been suggested as being involved in the development of airway inflammation and airway hyperresponsiveness.
- Formulation:
- Recombinant Human ICOS/CD278 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu21-Phe141) of human ICOS/CD278 (Accession #NP_036224.1) fused with
- Immunogen:
- Glu21-Phe141
- Molecular Weight:
- 50-60 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EINGSANYEMFIFHNGGVQILCKYPDIVQQFKMQLLKGGQILCDLTKTKGSGNTVSIKSLKFCHSQLSNNSVSFFLYNLDHSHANYYFCNLSIFDPPPFKVTLTGGYLHIYESQLCCQLKF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01401


