Recombinant Human TNFRSF18/GITR/CD357 Protein
Product Sizes
10 ug
£127.00
RP01399-10UG
20 ug
£175.00
RP01399-20UG
50 ug
£240.00
RP01399-50UG
100 ug
£336.00
RP01399-100UG
500 ug
£1002.00
RP01399-500UG
1000 ug
£1574.00
RP01399-1000UG
About this Product
- SKU:
- RP01399
- Additional Names:
- TNFRSF18,AITR,CD357,GITR,GITR-D
- Extra Details:
- GITR, also known as TNFRSF18(CD357), belongs to the tumor necrosis factor receptor (TNF-R) superfamily. It is the receptor for TNFSF18. GITR plays a key role in dominant immunological self-tolerance maintained by CD25(+)CD4(+) regulatory T cells. GITR may be involved in interactions between activated T-lymphocytes and endothelial cells and in the regulation of T-cell receptor-mediated cell death. GITR and its ligand are important costimulatory molecules in the pathogenesis of autoimmune diseases. It also mediates NF-kappa-B activation via the TRAF2/NIK pathway.
- Formulation:
- Recombinant Human TNFRSF18/GITR/CD357 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln26-Glu161) of human GITR/TNFRSF18 (Accession #NP_004186.1
- Immunogen:
- Gln26-Glu161
- Molecular Weight:
- 50-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QRPTGGPGCGPGRLLLGTGTDARCCRVHTTRCCRDYPGEECCSEWDCMCVQPEFHCGDPCCTTCRHHPCPPGQGVQSQGKFSFGFQCIDCASGTFSGGHEGHCKPWTDCTQFGFLTVFPGNKTHNAVCVPGSPPAE
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01399


