Recombinant Human IL-6RA/CD126 Protein
Product Sizes
10 ug
£133.00
RP01396-10UG
20 ug
£181.00
RP01396-20UG
50 ug
£240.00
RP01396-50UG
100 ug
£353.00
RP01396-100UG
About this Product
- SKU:
- RP01396
- Additional Names:
- IL6R,CD126,IL-6R-1,IL-6RA,IL6Q,IL6RA,IL6RQ,gp80
- Extra Details:
- Recombinant Human IL-6RA/CD126 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Asp358) of human IL-6R alpha/CD126 (Accession #NP_000556.1) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu20-Asp358
- Molecular Weight:
- 64.66 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LAPRRCPAQEVARGVLTSLPGDSVTLTCPGVEPEDNATVHWVLRKPAAGSHPSRWAGMGRRLLLRSVQLHDSGNYSCYRAGRPAGTVHLLVDVPPEEPQLSCFRKSPLSNVVCEWGPRSTPSLTTKAVLLVRKFQNSPAEDFQEPCQYSQESQKFSCQLAVPEGDSSFYIVSMCVASSVGSKFSKTQTFQGCGILQPDPPANITVTAVARNPRWLSVTWQDPHSWNSSFYRLRFELRYRAERSKTFTTWMVKDLQHHCVIHDAWSGLRHVVQLRAQEEFGQGEWSEWSPEAMGTPWTESRSPPAENEVSTPMQALTTNKDDDNILFRDSANATSLPVQD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01396
