Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein
Product Sizes
10 ug
£133.00
RP01394-10UG
20 ug
£181.00
RP01394-20UG
50 ug
£240.00
RP01394-50UG
100 ug
£353.00
RP01394-100UG
About this Product
- SKU:
- RP01394
- Additional Names:
- Fc gamma RIV,CD16-2,Fcgr4,FCGR4,mouse igg,FcgR4
- Extra Details:
- Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Gln 203) of mouse Fc gamma RIV/CD16-2 (Accession #NP_653142.2) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gly21-Gln203
- Molecular Weight:
- 21.77 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01394
