Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein

Product Sizes

10 ug

£133.00

RP01394-10UG

20 ug

£181.00

RP01394-20UG

50 ug

£240.00

RP01394-50UG

100 ug

£353.00

RP01394-100UG

500 ug

£1002.00

RP01394-500UG

1000 ug

£1574.00

RP01394-1000UG

About this Product

SKU:: RP01394
Additional Names:: Fc gamma RIV,CD16-2,Fcgr4,FCGR4,mouse igg,FcgR4
Extra Details:: FcgammaRIV is a relatively new IgG Fc receptor (FcgammaR) that is reported to contribute to the pathogenesis of autoimmune diseases.FcgammaRIII and FcgammaRIV are each essential to trigger an FcRgamma-linker for activation of T-cell-dependent signal that drives C5a production in the Arthus reaction. A combined requirement for FcgammaRIII and FcgammaRIV in autoimmune injury, and identify the linker for activation of T cells adaptor as an integral component of linked FcgammaR and C5a anaphylatoxin receptor activation to generate inflammation.
Formulation:: Recombinant Mouse Fc-gamma RIV/FCGR3A/CD16a Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly21-Gln 203) of mouse Fc gamma RIV/CD16-2 (Accession
Immunogen:: Gly21-Gln203
Molecular Weight:: 35-40 kDa
Physical State:: Lyophilized
Purity:: ≥95%
Sequence:: GLQKAVVNLDPKWVRVLEEDSVTLRCQGTFSPEDNSIKWFHNESLIPHQDANYVIQSARVKDSGMYRCQTALSTISDPVQLEVHMGWLLLQTTKWLFQEGDPIHLRCHSWQNRPVRKVTYLQNGKGKKYFHENSELLIPKATHNDSGSYFCRGLIGHNNKSSASFRISLGDPGSPSMFPPWHQ
Shipping Conditions:: Blue Ice
Storage Conditions:: -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
Supplier:: ABclonal Technology
Type:: Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins

Basket