Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein
Product Sizes
10 ug
£133.00
RP01389-10UG
20 ug
£181.00
RP01389-20UG
50 ug
£240.00
RP01389-50UG
100 ug
£353.00
RP01389-100UG
500 ug
£1002.00
RP01389-500UG
1000 ug
£1574.00
RP01389-1000UG
About this Product
- SKU:
- RP01389
- Additional Names:
- KIR2DL3,CD158B2,CD158b,GL183,KIR-023GB,KIR-K7b,KIR-K7c,KIR2DS5,KIRCL23,NKAT,NKAT2,NKAT2A,NKAT2B,p58
- Extra Details:
- Killer cell immunoglobulin-like receptor 2DL3, also known as CD158 antigen-like family member B2, KIR-23GB, Killer inhibitory receptor cl 2-3, MHC class I NK cell receptor, NKAT2a, NKAT2b, Natural killer-associated transcript 2, p58 natural killer cell receptor clone CL-6, p58.2 MHC class-I-specific NK receptor, CD158b2, and KIR2DL3, is a single-pass type I membrane protein which belongs to the immunoglobulin superfamily. KIR2DL3 contains 2 Ig-like C2-type (immunoglobulin-like) domains. KIR2DL3 interacts with ARRB2. KIR2DL3 is a receptor on natural killer (NK) cells for HLA-C alleles (HLA-Cw1, HLA-Cw3, and HLA-Cw7). KIR2DL3 inhibits the activity of NK cells thus preventing cell lysis.
- Formulation:
- Recombinant Human NKAT-2/KIR2DL3/CD158b2 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (His22-His245) of human KIR2DL3/CD158b2 (Accession #NP_056
- Immunogen:
- His22-His245
- Molecular Weight:
- 35-50 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- HEGVHRKPSLLAHPGPLVKSEETVILQCWSDVRFQHFLLHREGKFKDTLHLIGEHHDGVSKANFSIGPMMQDLAGTYRCYGSVTHSPYQLSAPSDPLDIVITGLYEKPSLSAQPGPTVLAGESVTLSCSSRSSYDMYHLSREGEAHERRFSAGPKVNGTFQADFPLGPATHGGTYRCFGSFRDSPYEWSNSSDPLLVSVTGNPSNSWPSPTEPSSETGNPRHLH
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01389
