Recombinant Mouse IL-3 Protein
Product Sizes
10 ug
£133.00
RP01386-10UG
20 ug
£181.00
RP01386-20UG
50 ug
£240.00
RP01386-50UG
100 ug
£353.00
RP01386-100UG
500 ug
£1002.00
RP01386-500UG
1000 ug
£1574.00
RP01386-1000UG
About this Product
- SKU:
- RP01386
- Additional Names:
- BPA,Csfmu,HCGF,IL-3,MCGF,PSF,IL3
- Extra Details:
- IL3 (interleukin 3), also known as IL-3, is a potent growth-promoting cytokine that belongs to the IL-3 family. IL3/IL-3 also belongs to the group of interleukins. Interleukins are produced by a wide variety of body cells. The function of the immune system depends in a large part on interleukins, and rare deficiencies of a number of them have been described, all featuring autoimmune diseases or immune deficiency. The majority of interleukins are synthesized by helper CD4+ T lymphocytes, as well as through monocytes, macrophages, and endothelial cells. They promote the development and differentiation of T, B, and hematopoietic cells. IL3/IL-3 is capable of supporting the proliferation of a broad range of hematopoietic cell types. It is involved in a variety of cell activities such as cell growth, differentiation, and apoptosis. IL3/IL-3 has been shown to also possess neurotrophic activity, and it may be associated with neurologic disorders.
- Formulation:
- Recombinant Mouse IL-3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Met1-Cys166) of mouse IL3 (Accession #NP_034686.2.) fused with a 6xHis tag
- Immunogen:
- Met1-Cys166
- Molecular Weight:
- 10-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- MVLASSTTSIHTMLLLLLMLFHLGLQASISGRDTHRLTRTLNCSSIVKEIIGKLPEPELKTDDEGPSLRNKSFRRVNLSKFVESQGEVDPEDRYVIKSNLQKLNCCLPTSANDSALPGVFIRDLDDFRKKLRFYMVHLNDLETVLTSRPPQPASGSVSPNRGTVEC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01386
