Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein
Product Sizes
10 ug
£133.00
RP01383-10UG
20 ug
£181.00
RP01383-20UG
50 ug
£240.00
RP01383-50UG
100 ug
£353.00
RP01383-100UG
500 ug
£1002.00
RP01383-500UG
1000 ug
£1574.00
RP01383-1000UG
About this Product
- SKU:
- RP01383
- Additional Names:
- FCGR2A,CD32,CD32A,CDw32,FCG2,FCGR2,FCGR2A1,FcGR,IGFR2
- Extra Details:
- Receptors for the Fc region of IgG (Fc G Gamma R) are members of the Ig superfamily that function in the activation or inhibition of immune responses. Three classes of human Fc G Gamma Rs: RI (CD64), RII (CD32), and RIII (CD16), which generate multiple isoforms, are recognized. There are three genes for human FcG Gamma RII /CD32 (A, B, and C) and one for mouse FcG Gamma RII B (CD32B). CD32 is a low affinity receptor for IgG. The activating isoform, CD32A, is expressed on monocytes, neutrophils, platelets and dendritic cells. CD32A is expressed on many immune cell types (macrophage, neutrophil, eosinophils, platelets, dendritic cells and Langerhan cells), where inhibitory ITIM-bearing receptors may also be coexpressed and co-engaged by specific ligands. CD32A delivers an activating signal upon ligand binding, and results in the initiation of inflammatory responses including cytolysis, phagocytosis, degranulation and cytokine production. The responses can be modulated by signals from the coexpressed inhibitory receptors such as CD32B, and the strength of the signal is dependent on the ratio of expression of the activating and inhibitory receptors.
- Formulation:
- Recombinant Human Fc gamma RIIA/FCGR2A/CD32a (H167R) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala36-Ile218(R167)) of human FCGR2A/CD32a(R16
- Immunogen:
- Ala36-Ile218(H167R)
- Molecular Weight:
- 60-65 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- AAPPKAVLKLEPPWINVLQEDSVTLTCQGARSPESDSIQWFHNGNLIPTHTQPSYRFKANNNDSGEYTCQTGQTSLSDPVHLTVLSEWLVLQTPHLEFQEGETIMLRCHSWKDKPLVKVTFFQNGKSQKFSHLDPTFSIPQANHSHSGDYHCTGNIGYTLFSSKPVRITVQVPSMGSSSPMGI
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01383


