Recombinant Human B29/CD79B Protein
Product Sizes
10 ug
£127.00
RP01381-10UG
20 ug
£175.00
RP01381-20UG
50 ug
£240.00
RP01381-50UG
100 ug
£336.00
RP01381-100UG
About this Product
- SKU:
- RP01381
- Additional Names:
- AGM6, B29, IGB,CD79B,B29,IGB
- Extra Details:
- Recombinant Human B29/CD79B Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala29-Asp159) of human CD79b/B29 (Accession #NP_000617.1) fused with a hFc tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala29-Asp159
- Molecular Weight:
- 41.16 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- ARSEDRYRNPKGSACSRIWQSPRFIARKRGFTVKMHCYMNSASGNVSWLWKQEMDENPQQLKLEKGRMEESQNESLATLTIQGIRFEDNGIYFCQQKCNNTSEVYQGCGTELRVMGFSTLAQLKQRNTLKD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01381










