Recombinant Human CCL17/TARC Protein
Product Sizes
50 ug
£240.00
RP01374-50UG
100 ug
£336.00
RP01374-100UG
About this Product
- SKU:
- RP01374
- Additional Names:
- CCL17,A-152E5.3,ABCD-2,SCYA17,TARC
- Extra Details:
- Recombinant Human CCL17/TARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser94) of human CCL17/TARC (Accession #NP_002978.1) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ala24-Ser94
- Molecular Weight:
- 34.87 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01374
