Recombinant Human CCL17/TARC Protein
Product Sizes
50 ug
£240.00
RP01374-50UG
100 ug
£336.00
RP01374-100UG
500 ug
£1002.00
RP01374-500UG
1000 ug
£1574.00
RP01374-1000UG
About this Product
- SKU:
- RP01374
- Additional Names:
- CCL17,A-152E5.3,ABCD-2,SCYA17,TARC
- Extra Details:
- There are four members of the chemokine family: C-C kemokines, C kemokines, CXC kemokines and CX3C kemokines. The C-C kemokines have two cysteines nearby the amino terminus. There have been at least 27 distinct members of this subgroup reported for mammals, called C-C chemokine ligands-1 to 28. Chemokin ligand 17 (CCL17), also known as thymus and activation regulated chemokine(TARC), is a small cytokine belonging to the C-C chemokine family. CCL17 is expressed maily in thymus and transiently in phytohemagglutinin-stimulated peripheral blood mononuclear cells. CCL17 can induce chemotaxis in T cells by binding with the chemokine receptor CCR4.
- Formulation:
- Recombinant Human CCL17/TARC Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala24-Ser94) of human CCL17/TARC (Accession #NP_002978.1) fused with
- Immunogen:
- Ala24-Ser94
- Molecular Weight:
- 35-40 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- ARGTNVGRECCLEYFKGAIPLRKLKTWYQTSEDCSRDAIVFVTVQGRAICSDPNNKRVKNAVKYLQSLERS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01374
