Recombinant Human LILRB2/ILT-4/CD85d Protein
Product Sizes
10 ug
£127.00
RP01372-10UG
20 ug
£175.00
RP01372-20UG
50 ug
£240.00
RP01372-50UG
100 ug
£336.00
RP01372-100UG
500 ug
£1002.00
RP01372-500UG
1000 ug
£1574.00
RP01372-1000UG
About this Product
- SKU:
- RP01372
- Additional Names:
- LILRB2,CD85D,ILT-4,ILT4,LIR-2,LIR2,MIR-10,MIR10
- Extra Details:
- Leukocyte immunoglobulin-like receptor subfamily B member 2 (LILRB2) is also known as CD85 antigen-like family member D (CD85d), Immunoglobulin-like transcript 4 (ILT-4), Monocyte / macrophage immunoglobulin-like receptor 10 (MIR-10), which is a member of the the subfamily B class of LIR receptors.Multiple transcript variants encoding different isoforms have been found for the ILT4 gene. ILT4 is expressed on immune cells where it binds to MHC class I molecules on antigen-presenting cells and transduces a negative signal that inhibits stimulation of an immune response. It is thought to control inflammatory responses and cytotoxicity to help focus the immune response and limit autoreactivity.
- Formulation:
- Recombinant Human LILRB2/ILT-4/CD85d Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln22-Val461) of human LILRB2/CD85d/ILT4 (Accession #AAH36827
- Immunogen:
- Gln22-Val461
- Molecular Weight:
- 100-110 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QTGTIPKPTLWAEPDSVITQGSPVTLSCQGSLEAQEYRLYREKKSASWITRIRPELVKNGQFHIPSITWEHTGRYGCQYYSRARWSELSDPLVLVMTGAYPKPTLSAQPSPVVTSGGRVTLQCESQVAFGGFILCKEGEEEHPQCLNSQPHARGSSRAIFSVGPVSPNRRWSHRCYGYDLNSPYVWSSPSDLLELLVPGVSKKPSLSVQPGPVVAPGESLTLQCVSDVGYDRFVLYKEGERDLRQLPGRQPQAGLSQANFTLGPVSRSYGGQYRCYGAHNLSSECSAPSDPLDILITGQIRGTPFISVQPGPTVASGENVTLLCQSWRQFHTFLLTKAGAADAPLRLRSIHEYPKYQAEFPMSPVTSAHAGTYRCYGSLNSDPYLLSHPSEPLELVVSGPSMGSSPPPTGPISTPAGPEDQPLTPTGSDPQSGLGRHLGV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01372
