Recombinant Human B7-H3/CD276 Protein
Product Sizes
10 ug
£133.00
RP01371-10UG
20 ug
£181.00
RP01371-20UG
50 ug
£240.00
RP01371-50UG
100 ug
£353.00
RP01371-100UG
About this Product
- SKU:
- RP01371
- Additional Names:
- CD276, 4Ig-B7-H3, B7-H3, B7H3, B7RP-2, CD276 antigen,4Ig-B7-H3,B7-H3,B7H3,B7RP-2
- Extra Details:
- Recombinant Human B7-H3/CD276 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu29-Pro245) of human B7-H3/CD276 (Accession #NP_079516) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Leu29-Pro245
- Molecular Weight:
- 50.00 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥ 95 % as determined by SDS-PAGE;≥ 90 %
- Sequence:
- LEVQVPEDPVVALVGTDATLCCSFSPEPGFSLAQLNLIWQLTDTKQLVHSFAEGQDQGSAYANRTALFPDLLAQGNASLRLQRVRVADEGSFTCFVSIRDFGSAAVSLQVAAPYSKPSMTLEPNKDLRPGDTVTITCSSYRGYPEAEVFWQDGQGVPLTGNVTTSQMANEQGLFDVHSVLRVVLGANGTYSCLVRNPVLQQDAHGSVTITGQPMTFP
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01371
