Recombinant Human Fc-gamma RIII alpha/CD16a(F176V) Protein
Product Sizes
10 ug
£133.00
RP01366-10UG
20 ug
£181.00
RP01366-20UG
50 ug
£240.00
RP01366-50UG
100 ug
£353.00
RP01366-100UG
500 ug
£1002.00
RP01366-500UG
1000 ug
£1574.00
RP01366-1000UG
About this Product
- SKU:
- RP01366
- Additional Names:
- CD16,CD16A,FCG3,FCGR3,FCGRIII,FCR-10,FCRIII,FCRIIIA,IGFR3,IMD20,FCGR3A
- Extra Details:
- This protein is a receptor for the Fc portion of immunoglobulin G, and it is involved in the removal of antigen-antibody complexes from the circulation, as well as other other antibody-dependent responses. The protein is expressed on natural killer (NK) cells as an integral membrane glycoprotein anchored through a transmembrane peptide, whereas FCGR3B is expressed on polymorphonuclear neutrophils (PMN) where the receptor is anchored through a phosphatidylinositol (PI) linkage. Mutations in this gene have been linked to susceptibility to recurrent viral infections, susceptibility to systemic lupus erythematosus, and alloimmune neonatal neutropenia.
- Formulation:
- Recombinant Human Fc-gamma RIII alpha/CD16a(F176V) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly17-Gln208(F176V)) of human FCGR3A/CD16A(F176
- Immunogen:
- Gly17-Gln208(F176V)
- Molecular Weight:
- 40-55 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNSTQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAPRWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYFCRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQ
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01366
