Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein
Product Sizes
10 ug
£133.00
RP01361-10UG
20 ug
£181.00
RP01361-20UG
50 ug
£240.00
RP01361-50UG
100 ug
£353.00
RP01361-100UG
500 ug
£1002.00
RP01361-500UG
1000 ug
£1574.00
RP01361-1000UG
About this Product
- SKU:
- RP01361
- Additional Names:
- BTN6, BTNL11, MOGIG2, NRCLP7,MOG,BTNL11,MOGIG2,NRCLP7
- Extra Details:
- Myelin oligodendrocyte glycoprotein (MOG) is a transmembrane protein belonging to the immunoglobulin superfamily and contains an Ig-like domain followed by two potential membrane-spanning regions. MOG is expressed only in the CNS with very low content (approximately 0.1% total proteins) in the oligodendrogliocyte membrane. Three possible functions for MOG were suggested: (a) a cellular adhesive molecule, (b) a regulator of oligodendrocyte microtubule stability, and (c) a mediator of interactions between myelin and the immune system, in particular, the complement cascade. A direct interaction might exist between the membrane-associated regions of MOG and the myelin-specific glycolipid galactocerebroside (Gal-C), and such an interaction may have important consequences regarding the membrane topology and function of both molecules. It is considered that MOG is an autoantigen capable to produce demyelinating multiple sclerosis-like diseases in experimental animals.
- Formulation:
- Recombinant Human Myelin oligodendrocyte glycoprotein/MOFG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly30-Gly154) of human MOG (Accession #
- Immunogen:
- Gly30-Gly154
- Molecular Weight:
- 15-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GQFRVIGPRHPIRALVGDEVELPCRISPGKNATGMEVGWYRPPFSRVVHLYRNGKDQDGDQAPEYRGRTELLKDAIGEGKVTLRIRNVRFSDEGGFTCFFRDHSYQEEAAMELKVEDPFYWVSPG
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01361
