Recombinant Human CD34 Protein
Product Sizes
10 ug
£127.00
RP01359-10UG
20 ug
£157.00
RP01359-20UG
50 ug
£223.00
RP01359-50UG
100 ug
£336.00
RP01359-100UG
500 ug
£937.00
RP01359-500UG
1000 ug
£1478.00
RP01359-1000UG
About this Product
- SKU:
- RP01359
- Additional Names:
- CD34, CD34 molecule,CD34 molecule,GIG3,MORT1
- Extra Details:
- The CD34 protein is a member of a family of single-pass transmembrane sialomucin proteins that show expression on early hematopoietic and vascular-associated tissue. CD34 is also an important adhesion molecule and is required for T cells to enter lymph nodes. It is expressed on lymph node endothelia whereas the L-selectin to which it binds is on the T cell. It was indicated that CD34 is a phosphorylation target for activated PKC, and couples to the hematopoietic adapter protein CrkL, which were involved in CD34 signaling pathways. CD34 is abberantly expressed in many kinds of tumors and is implicated in leukemogenesis.
- Formulation:
- Recombinant Human CD34 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser32-Thr290) of human CD34 (Accession #NP_001020280.1) fused with a Fc, 6x
- Immunogen:
- Ser32-Thr290
- Molecular Weight:
- 100-120 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01359
