Recombinant Human CD34 Protein
Product Sizes
10 ug
£127.00
RP01359-10UG
20 ug
£157.00
RP01359-20UG
50 ug
£223.00
RP01359-50UG
100 ug
£336.00
RP01359-100UG
About this Product
- SKU:
- RP01359
- Additional Names:
- CD34, CD34 molecule,CD34 molecule,GIG3,MORT1
- Extra Details:
- Recombinant Human CD34 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ser32-Thr290) of human CD34 (Accession #NP_001020280.1) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Ser32-Thr290
- Molecular Weight:
- 54.27 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- SLDNNGTATPELPTQGTFSNVSTNVSYQETTTPSTLGSTSLHPVSQHGNEATTNITETTVKFTSTSVITSVYGNTNSSVQSQTSVISTVFTTPANVSTPETTLKPSLSPGNVSDLSTTSTSLATSPTKPYTSSSPILSDIKAEIKCSGIREVKLTQGICLEQNKTSSCAEFKKDRGEGLARVLCGEEQADADAGAQVCSLLLAQSEVRPQCLLLVLANRTEISSKLQLMKKHQSDLKKLGILDFTEQDVASHQSYSQKT
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01359
