Recombinant Mouse FGF-2/bFGF Protein
Product Sizes
10 ug
£115.00
RP01345-10UG
20 ug
£145.00
RP01345-20UG
50 ug
£193.00
RP01345-50UG
100 ug
£276.00
RP01345-100UG
500 ug
£764.00
RP01345-500UG
1000 ug
£1193.00
RP01345-1000UG
About this Product
- SKU:
- RP01345
- Additional Names:
- FGF2,BFGF,FGFB,FGF basic,HBGF-2,FGFb
- Extra Details:
- Basic fibroblast growth factor (bFGF), also known as FGF2, is a member of the fibroblast growth factor (FGF) family. It is a highly specific chemotactic and mitogenic factor for many cell types, appears to be involved in remodeling damaged tissue, such as ulcer healing, vascular repair, traumatic brain injury (TBI). bFGF is a critical component of human embryonic stem cell culture medium. In addition, bFGF protein is a heparin-binding cationic protein involved in a variety of pathological conditions including angiogenesis and solid tumour growth. Thus, bFGF is regarded as a target for cancers chemopreventive and therapeutic strategies.
- Formulation:
- Recombinant Mouse FGF-2/bFGF Protein is produced by E. coli expression system. The target protein is expressed with sequence (Ala11-Ser154) of mouse FGF2/FGFB (Accession #NP_032032.1) fused with 6xHis
- Immunogen:
- Ala11-Ser154
- Molecular Weight:
- 22 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- ALPEDGGAAFPPGHFKDPKRLYCKNGGFFLRIHPDGRVDGVREKSDPHVKLQLQAEERGVVSIKGVCANRYLAMKEDGRLLASKCVTEECFFFERLESNNYNTYRSRKYSSWYVALKRTGQYKLGSKTGPGQKAILFLPMSAKS
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01345
