Recombinant Human TNFSF14/LIGHT/HVEM-L/CD258 Protein
Product Sizes
10 ug
£133.00
RP01336-10UG
20 ug
£181.00
RP01336-20UG
50 ug
£240.00
RP01336-50UG
100 ug
£353.00
RP01336-100UG
500 ug
£1002.00
RP01336-500UG
1000 ug
£1574.00
RP01336-1000UG
About this Product
- SKU:
- RP01336
- Additional Names:
- TNFSF14,CD258,HVEML,LIGHT,LTg
- Extra Details:
- LIGHT, also known as TNFSF14 or CD258, is a newly identified member of the TNF superfamily (TNFSF14) that is expressed by activated T lymphocytes, monocytes, granulocytes, spleen cells, and immature dendritic cells. TNFSF14 / LIGHT / CD258 is a type II transmembrane protein that is known to bind 2 membrane-bound TNFSF signaling receptors: HVEM, which is predominantly expressed by T cells, and lymphotoxin B Beta receptor (LTB BetaR), which is expressed by stromal cells and nonlymphoid hematopoietic cells. TNFSF14 / LIGHT / CD258 also binds to a soluble non-signaling receptor, decoy receptor 3 (DcR3), which can modulate the function of LIGHT in vivo. TNFSF14 / LIGHT / CD258 can also costimulate T cell responses via HVEM, which is constitutively expressed in most lymphocyte subpopulations, including CD4+and CD8+T cells. In addition, TNFSF14 / LIGHT / CD258 has been shown to suppress tumor formation in vivo and to induce tumor cell apoptosis via the up-regulation of intercellular adhesion molecule 1 and an increased lymphocyte adhesion to cancer cells. Thus, TNFSF14 / LIGHT / CD258 is being actively investigated as a possible basis for cancer treatment.
- Formulation:
- Recombinant Human TNFSF14/LIGHT/HVEM-L/CD258 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Asp74-Val240) of Human TNFSF14 (Accession #NP_003798.
- Immunogen:
- Asp74-Val240
- Molecular Weight:
- 20-25 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- DGPAGSWEQLIQERRSHEVNPAAHLTGANSSLTGSGGPLLWETQLGLAFLRGLSYHDGAL VVTKAGYYYIYSKVQLGGVGCPLGLASTITHGLYKRTPRYPEELELLVSQQSPCGRATSS SRVWWDSSFLGGVVHLEAGEKVVVRVLDERLVRLRDGTRSYFGAFMV
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01336
