Recombinant SARS-COV-2 Spike RBD(E484K) Protein
Product Sizes
10 ug
£127.00
RP01330-10UG
20 ug
£175.00
RP01330-20UG
50 ug
£240.00
RP01330-50UG
100 ug
£336.00
RP01330-100UG
About this Product
- SKU:
- RP01330
- Additional Names:
- S1-RBD protein,NCP-CoV RBD Protein,novel coronavirus RBD Protein,2019-nCoV RBD Protein,S glycoprotein Subunit1 RBD Protein,RBD
- Extra Details:
- Recombinant SARS-COV-2 Spike RBD(E484K) Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg319-Phe541(E484K)) of SARS-COV-2 RBD (Accession #YP_009724390.1) fused with an 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Arg319-Phe541(E484K)
- Molecular Weight:
- 25.93 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RVQPTESIVRFPNITNLCPFGEVFNATRFASVYAWNRKRISNCVADYSVLYNSASFSTFKCYGVSPTKLNDLCFTNVYADSFVIRGDEVRQIAPGQTGKIADYNYKLPDDFTGCVIAWNSNNLDSKVGGNYNYLYRLFRKSNLKPFERDISTEIYQAGSTPCNGVKGFNCYFPLQSYGFQPTNGVGYQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKCVNF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01330
