Recombinant Mouse B7-H5/Gi24/VISTA Protein
Product Sizes
10 ug
£133.00
RP01328-10UG
20 ug
£181.00
RP01328-20UG
50 ug
£240.00
RP01328-50UG
100 ug
£353.00
RP01328-100UG
500 ug
£1002.00
RP01328-500UG
1000 ug
£1574.00
RP01328-1000UG
About this Product
- SKU:
- RP01328
- Additional Names:
- B7-H5,Gi24,VISTA,SISP1,VISTA
- Extra Details:
- VSIR, V-Set Immunoregulatory Receptor, also known as VISTA, is an immunoregulatory receptor that inhibits the T-cell response. It may promote differentiation of embryonic stem cells, by inhibiting BMP4 signaling. VSIR, or V-set immunoregulatory receptor, could be involved in the pathogenesis of chronic rhinosinusitis with nasal polyps. V-domain Immunoglobulin Suppressor of T cell Activation (VISTA) is an inhibitory immune-checkpoint molecule that suppresses CD4+ and CD8+ T cell activation when expressed on antigen-presenting cells. VSIR is broadly expressed in the spleen, bone marrow, and other tissues. Diseases associated with VSIR include Ichthyosis, Congenital, Autosomal Recessive 6, and Monckeberg Arteriosclerosis.
- Formulation:
- Recombinant Mouse B7-H5/Gi24/VISTA Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe33 - Ala191) of Mouse VISTA (Accession #NP_083008.1) fused w
- Immunogen:
- Phe33-Ala191
- Molecular Weight:
- 35-45 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- FKVTTPYSLYVCPEGQNATLTCRILGPVSKGHDVTIYKTWYLSSRGEVQMCKEHRPIRNF TLQHLQHHGSHLKANASHDQPQKHGLELASDHHGNFSITLRNVTPRDSGLYCCLVIELKN HHPEQRFYGSMELQVQAGKGSGSTCMASNEQDSDSITAA
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01328
