Recombinant Mouse CTLA-4/CD152 Protein
Product Sizes
10 ug
£115.00
RP01326-10UG
20 ug
£145.00
RP01326-20UG
50 ug
£193.00
RP01326-50UG
100 ug
£276.00
RP01326-100UG
500 ug
£764.00
RP01326-500UG
1000 ug
£1193.00
RP01326-1000UG
About this Product
- SKU:
- RP01326
- Additional Names:
- Cd152,Ctla-4,Ly-56,CTLA4
- Extra Details:
- Cytotoxic T-lymphocyte protein 4, also known as CTLA4 and CD152, is a single-pass type I membrane protein and a member of the immunoglobulin superfamily. It is the second member of the CD28 receptor family,and is similar to the T-cell co-stimulatory protein, CD28, both molecules bind to CD80 and CD86, also called B7-1 and B7-2 respectively, on antigen-presenting cells. CTLA4 transmits an inhibitory signal to T cells, whereas CD28 transmits a stimulatory signal.Intracellular CTLA4 is also found in regulatory T cells, CD152 or cytotoxic T lymphocyte antigen-4 (CTLA-4) is an essential receptor involved in the negative regulation of T cell activation. Because of its profound inhibitory role, CD152 has been considered a sound susceptible candidate in autoimmunity and a persuasive target for cancer immunotherapy.
- Formulation:
- Recombinant Mouse CTLA-4/CD152 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu36-Asp161) of Mouse CTLA4 (Accession #NP_033973.2) fused with an
- Immunogen:
- Glu36-Asp161
- Molecular Weight:
- 20-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EAIQVTQPSVVLASSHGVASFPCEYSPSHNTDEVRVTVLRQTNDQMTEVCATTFTEKNTV GFLDYPFCSGTFNESRVNLTIQGLRAVDTGLYLCKVELMYPPPYFVGMGNGTQIYVIDPE PCPDSD
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01326
