Recombinant Mouse TNFRSF5/CD40 Protein
Product Sizes
10 ug
£133.00
RP01325-10UG
20 ug
£181.00
RP01325-20UG
50 ug
£240.00
RP01325-50UG
100 ug
£353.00
RP01325-100UG
500 ug
£1002.00
RP01325-500UG
1000 ug
£1574.00
RP01325-1000UG
About this Product
- SKU:
- RP01325
- Additional Names:
- CD40,Bp50,CDW40,MGC9013,TNFRSF5,p50,CD40
- Extra Details:
- CD40, also known as TNFRSF5, is a member of the TNF receptor superfamily which are single transmembrane-spanning glycoproteins.plays an essential role in mediating a broad variety of immune and inflammatory responses including T cell-dependent immunoglobulin class switching, memory B cell development, and germinal center formation.CD40 is a costimulatory protein found on antigen presenting cells and is required for their activation, and is expressed in B cells, dendritic cells, macrophages, endothelial cells, and several tumor cell lines.Interaction of CD40 with its ligand, CD40L, leads to aggregation of CD40 molecules,which in turn interact with cytoplasmic components to initiate signaling pathways. Early studies on the CD40-CD40L system revealed its role in humoral immunity. Defects in CD40 result in hyper-IgM immunodeficiency type 3 (HIGM3).
- Formulation:
- Recombinant Mouse TNFRSF5/CD40 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu20-Arg193) of Mouse CD40 (Accession #NP_035741.2) fused with an
- Immunogen:
- Leu20-Arg193
- Molecular Weight:
- 25-30 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LGQCVTCSDKQYLHDGQCCDLCQPGSRLTSHCTALEKTQCHPCDSGEFSAQWNREIRCHQ HRHCEPNQGLRVKKEGTAESDTVCTCKEGQHCTSKDCEACAQHTPCIPGFGVMEMATETT DTVCHPCPVGFFSNQSSLFEKCYPWTSCEDKNLEVLQKGTSQTNVICGLKSRMR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01325
