Recombinant Rat VEGF-A/VEGF164 Protein
Product Sizes
10 ug
£145.00
RP01323-10UG
20 ug
£193.00
RP01323-20UG
50 ug
£288.00
RP01323-50UG
100 ug
£431.00
RP01323-100UG
500 ug
£1240.00
RP01323-500UG
1000 ug
£1954.00
RP01323-1000UG
About this Product
- SKU:
- RP01323
- Additional Names:
- MVCD1,VAS,vascular endothelial growth factor A,Vasculotropin,VEGF,VEGFA,VEGF-A,VEGFMGC70609,VPF,VEGFA
- Extra Details:
- Vascular endothelial growth factor A (VEGFA),also known as Vascular permeability factor (VPF). VEGFA belongs to the PDGF/VEGF growth factor family. VEGFA is a glycosylated mitogen that specifically acts on endothelial cells and has various effects, including mediating increased vascular permeability, inducing angiogenesis, vasculogenesis and endothelial cell growth, promoting cell migration, and inhibiting apoptosis. Alternatively spliced transcript variants, encoding either freely secreted or cell-associated isoforms, have been characterized. VEGFA is produced by a group of three major isoforms as a result of alternative splicing and if any three isoforms are produced (VEGFA120, VEGFA164, and VEGFA188) then this will not result in vessel defects and death of the full VEGFA knockout in mice.
- Formulation:
- Recombinant Rat VEGF-A/VEGF164 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Ala27-Arg190) of Rat VEGFA (Accession #NP_001274037.1) fused with a
- Immunogen:
- Ala27-Arg190
- Molecular Weight:
- 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- APTTEGEQKAHEVVKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNVTMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01323


