Recombinant Rat TNF-alpha Protein
Product Sizes
20 ug
£193.00
RP01322-20UG
50 ug
£288.00
RP01322-50UG
100 ug
£431.00
RP01322-100UG
500 ug
£1240.00
RP01322-500UG
1000 ug
£1954.00
RP01322-1000UG
About this Product
- SKU:
- RP01322
- Additional Names:
- DIF,TNF-alpha,TNFA,TNFSF2,cachexin,cachectin,TNFA Alpha,TNFA
- Extra Details:
- Tumor necrosis factor alpha is a cytokine produced primarily by monocytes and macrophages. It is found in synovial cells and macrophages in the tissues.The primary role of TNFA Alpha is in the regulation of immune cells. TNFA Alpha is able to induce apoptotic cell death, to induce inflammation, and to inhibit tumorigenesis and viral replication. Dysregulation of TNFA Alpha production has been implicated in a variety of human diseases, including major depression, Alzheimer's disease and cancer. Recombinant TNFA Alpha is used as an immunostimulant under the INN tasonermin.TNF-alpha is involved in fighting against the tumorigenesis, thus, is regarded as a molecular insight in cancer treatment.
- Formulation:
- Recombinant Rat TNF-alpha Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Leu80-Leu235) of Rat TNFA (Accession #NP_036807.1) fused with an 6xHis t
- Immunogen:
- Leu80-Leu235
- Molecular Weight:
- 18 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- LRSSSQNSSDKPVAHVVANHQAEEQLEWLSQRANALLANGMDLKDNQLVVPADGLYLIYS QVLFKGQGCPDYVLLTHTVSRFAISYQEKVSLLSAIKSPCPKDTPEGAELKPWYEPMYLG GVFQLEKGDLLSAEVNLPKYLDITESGQVYFGVIAL
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01322


