Recombinant Human IL-13 Protein
Product Sizes
10 ug
£145.00
RP01320-10UG
20 ug
£193.00
RP01320-20UG
50 ug
£288.00
RP01320-50UG
500 ug
£1240.00
RP01320-500UG
1000 ug
£1954.00
RP01320-1000UG
100 ug
£3858.00
RP01320-100UG
About this Product
- SKU:
- RP01320
- Additional Names:
- IL13,IL-13,P600
- Extra Details:
- Interleukin 13 (IL13) is also known as ALRH,and P600, is a single-chain glycosylated polypeptide, and is a cytokine critical in regulating inflammatory and immune responses. IL13 is secreted by many cell types, but especially by T helper type 2 (Th2) cells. IL-13 induces its effects through a multi-subunit receptor that includes the alpha chain of the IL-4 receptor (IL-4RA Alpha) and at least one of two known IL-13-specific binding chains.As a cytokine, IL-13 protein is critical in regulating inflammatory, immune responses, and diseases. Also, it inhibits the production of pro-inflammatory cytokines and chemokines, and thus down-regulates macrophage activity. IL-13 protein and antibody are more importantly implicated as a central mediator of immunoregulatory processes in various cell types.
- Formulation:
- Recombinant Human IL-13 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gly35-Asn146) of Human IL13 (Accession #NP_002179.2) fused with an 6xHis t
- Immunogen:
- Gly35-Asn146
- Molecular Weight:
- 15 kDa, 25-35 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- GPVPPSTALRELIEELVNITQNQKAPLCNGSMVWSINLTAGMYCAALESLINVSGCSAIEKTQRMLSGFCPHKVSAGQFSSLHVRDTKIEVAQFVKDLLLHLKKLFREGRFN
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01320
