Recombinant MERS-CoV Spike RBD Protein
Product Sizes
10 ug
£133.00
RP01311-10UG
50 ug
£240.00
RP01311-50UG
100 ug
£353.00
RP01311-100UG
About this Product
- SKU:
- RP01311
- Additional Names:
- MERS-CoV Spike RBD
- Extra Details:
- Recombinant MERS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Glu367-Tyr606) of mers-cov Spike RBD (Accession #AFS88936.1) fused with an 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Glu367-Tyr606
- Molecular Weight:
- 27.11 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- EAKPSGSVVEQAEGVECDFSPLLSGTPPQVYNFKRLVFTNCNYNLTKLLSLFSVNDFTCSQISPAAIASNCYSSLILDYFSYPLSMKSDLSVSSAGPISQFNYKQSFSNPTCLILATVPHNLTTITKPLKYSYINKCSRLLSDDRTEVPQLVNANQYSPCVSIVPSTVWEDGDYYRKQLSPLEGGGWLVASGSTVAMTEQLQMGFGITVQYGTDTNSVCPKLEFANDTKIASQLGNCVEY
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01311
