Recombinant Mouse Noggin/NOG Protein
Product Sizes
10 ug
£127.00
RP01308-10UG
20 ug
£181.00
RP01308-20UG
50 ug
£240.00
RP01308-50UG
100 ug
£336.00
RP01308-100UG
500 ug
£1002.00
RP01308-500UG
1000 ug
£1574.00
RP01308-1000UG
About this Product
- SKU:
- RP01308
- Additional Names:
- noggin,NOG
- Extra Details:
- Noggin is a secreted protein involved at multiple stages of vertebrate embryonic development including neural induction and is known to exert its effects by inhibiting the bone morphogenetic protein (BMP)-signaling pathway. It binds several BMPs with very high (picomolar) affinities, with a marked preference for BMP2 and BMP4 over BMP7. By binding tightly to BMPs, Noggin prevents BMPs from binding their receptors. Noggin binds the bone morphogenetic proteins (BMP) such as BMP-4 and BMP-7 and inhibits BMP signaling by blocking the molecular interfaces of the binding epitopes for both types I and type II receptors. Interaction of BMP and its antagonist Noggin governs various developmental and cellular processes, including embryonic dorsal-ventral axis, induction of neural tissue, the formation of joints in the skeletal system, and neurogenesis in the adult brain. Noggin plays a key role in neural induction by inhibiting BMP4, along with other TGF-B Beta signaling inhibitors such as chordin and follistatin. Mouse knockout experiments have demonstrated that noggin also plays a crucial role in bone development, joint formation, and neural tube fusion.
- Formulation:
- Recombinant Mouse Noggin/NOG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln28-Cys232) of mouse Noggin (Accession #NP_032737.1) fused with an
- Immunogen:
- Gln28-Cys232
- Molecular Weight:
- 36 kda
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01308
