Recombinant Mouse Noggin/NOG Protein
Product Sizes
10 ug
£127.00
RP01308-10UG
50 ug
£240.00
RP01308-50UG
100 ug
£336.00
RP01308-100UG
About this Product
- SKU:
- RP01308
- Additional Names:
- noggin,NOG
- Extra Details:
- Recombinant Mouse Noggin/NOG Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Gln28-Cys232) of mouse Noggin (Accession #NP_032737.1) fused with an 6xHis tag at the C-terminus.
- Formulation:
- Lyophilized from a 0.22 um filtered solution of PBS, pH 7.4.
- Immunogen:
- Gln28-Cys232
- Molecular Weight:
- 24.75 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- QHYLHIRPAPSDNLPLVDLIEHPDPIFDPKEKDLNETLLRSLLGGHYDPGFMATSPPEDRPGGGGGPAGGAEDLAELDQLLRQRPSGAMPSEIKGLEFSEGLAQGKKQRLSKKLRRKLQMWLWSQTFCPVLYAWNDLGSRFWPRYVKVGSCFSKRSCSVPEGMVCKPSKSVHLTVLRWRCQRRGGQRCGWIPIQYPIISECKCSC
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01308










