Recombinant SARS-CoV Spike RBD Protein
Product Sizes
100 ug
£353.00
RP01299-100UG
500 ug
£1002.00
RP01299-500UG
1000 ug
£1574.00
RP01299-1000UG
About this Product
- SKU:
- RP01299
- Additional Names:
- Spike,Spike RBD,Spike S1
- Extra Details:
- Recombinant SARS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg306-Phe527) of sars-cov Spike RBD (Accession #NP_828851.1) fused with a 6xHis tag at the C-terminus.
- Formulation:
- Recombinant SARS-CoV Spike RBD Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Arg306-Phe527) of sars-cov Spike RBD (Accession #NP_828851.1) fused
- Immunogen:
- Arg306-Phe527
- Molecular Weight:
- 36-40
- Physical State:
- Lyophilized
- Purity:
- ≥95%
- Sequence:
- RVVPSGDVVRFPNITNLCPFGEVFNATKFPSVYAWERKKISNCVADYSVLYNSTFFSTFKCYGVSATKLNDLCFSNVYADSFVVKGDDVRQIAPGQTGVIADYNYKLPDDFMGCVLAWNTRNIDATSTGNYNYKYRYLRHGKLRPFERDISNVPFSPDGKPCTPPALNCYWPLNDYGFYTTTGIGYQPYRVVVLSFELLNAPATVCGPKLSTDLIKNQCVNF
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Recombinant Proteins
- Manufacturer's Data Sheet:RP01299


