Recombinant Cynomolgus Siglec-15/CD33L3 Protein
Product Sizes
10 ug
£193.00
RP01292-10UG
50 ug
£383.00
RP01292-50UG
100 ug
£586.00
RP01292-100UG
500 ug
£1716.00
RP01292-500UG
1000 ug
£2716.00
RP01292-1000UG
About this Product
- SKU:
- RP01292
- Additional Names:
- sialic acid-binding Ig-like lectin 15,CD33 antigen-like 3,SIGLEC15,Siglec15,SIGLEC15,sialic acid-binding Ig-like lectin 15,CD33 antigen-like 3,SIGLEC15,Siglec15,SIGLEC15
- Extra Details:
- Recombinant Cynomolgus Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of cynomolgus Siglec-15/CD33L3 (Accession #XP_005586866.1) fused with a Fc, 6xHis tag at the C-terminus.
- Formulation:
- Recombinant Cynomolgus Siglec-15/CD33L3 Protein is produced by HEK293 cells expression system. The target protein is expressed with sequence (Phe20-Thr263) of cynomolgus Siglec-15/CD33L3 (Accession #X
- Immunogen:
- Phe20-Thr263
- Molecular Weight:
- 60-70 kDa
- Physical State:
- Lyophilized
- Purity:
- ≥90%
- Sequence:
- FVRTKIDTTENLLNTEVHSSPAQRWSMQVPAEVSAAAGDAAVLPCTFTHPHRHYDGPLTAIWRAGEPYAGPQVFRCAAARGSELCQTALSLHGRFRLLGNPRRNDLSLRVERLALADDRRYFCRVEFAGDVHDRYESRHGVRLHVTAAPRIINISVLPGPAHAFRALCTAEGEPPPALAWSGPALGNGSAAVPSSGQGHGHLVTAELPALNHDGRYTCTAANSLGRSEASVYLFRFHGASGAST
- Shipping Conditions:
- Blue Ice
- Storage Conditions:
- -20[o]C reconstituted. Avoid freeze/thaw cycles., 2-8[o]C reconstituted., -20[o]C/-70[o]C lyophilized. Avoid freeze/thaw cycles.
- Supplier:
- ABclonal Technology
- Type:
- Proteins, Peptides, Small Molecules & Other Biomolecules: Lectins
- Manufacturer's Data Sheet:RP01292
